HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A5U3V1",
"id": "A5U3V1_MYCTA",
"source_organism": {
"taxId": "419947",
"scientificName": "Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)",
"fullName": "Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)"
},
"name": "Thiol peroxidase",
"description": [
"Thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides to water and alcohols, respectively. Plays a role in cell protection against oxidative stress by detoxifying peroxides"
],
"length": 165,
"sequence": "MAQITLRGNAINTVGELPAVGSPAPAFTLTGGDLGVISSDQFRGKSVLLNIFPSVDTPVCATSVRTFDERAAASGATVLCVSKDLPFAQKRFCGAEGTENVMPASAFRDSFGEDYGVTIADGPMAGLLARAIVVIGADGNVAYTELVPEIAQEPNYEAALAALGA",
"proteome": "UP000001988",
"gene": "tpx",
"go_terms": [
{
"identifier": "GO:0008379",
"name": "thioredoxin peroxidase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0016209",
"name": "antioxidant activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0016491",
"name": "oxidoreductase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0016684",
"name": "oxidoreductase activity, acting on peroxide as acceptor",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "bf620472e95c549e5bef1560f4101b9ffe90cbef",
"counters": {
"domain_architectures": 60130,
"entries": 15,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"cathgene3d": 1,
"profile": 1,
"cdd": 1,
"pfam": 1,
"ncbifam": 1,
"panther": 1,
"hamap": 1,
"prosite": 1,
"interpro": 6
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 60130
}
}
}