HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A5JMX7",
"id": "A5JMX7_9GAMM",
"source_organism": {
"taxId": "442938",
"scientificName": "Pectobacterium sp. Psp939",
"fullName": "Pectobacterium sp. Psp939"
},
"name": "Malate dehydrogenase",
"description": [
"Catalyzes the reversible oxidation of malate to oxaloacetate"
],
"length": 146,
"sequence": "DLSHIPTAVKIKGYSGEDAKPALVGADIVLISAGVARKPGMDRSDLFNVNAGIVRNLVEQIAVTCPKACIGIITNPVNTTVAIAAEVLKKAGVYDKNKLFGVTTLDIIRSNTFVAELKGKQPQDINVPVIGGHSGVTILPLLSQVS",
"proteome": null,
"gene": "mdh",
"go_terms": [
{
"identifier": "GO:0016491",
"name": "oxidoreductase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0003824",
"name": "catalytic activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0016616",
"name": "oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0016615",
"name": "malate dehydrogenase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006108",
"name": "malate metabolic process",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": true,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "efa9ddffcabca3280ae0d7a3462c2f8e6d373a42",
"counters": {
"domain_architectures": 58034,
"entries": 13,
"isoforms": 0,
"proteomes": 0,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"pfam": 2,
"cathgene3d": 2,
"ssf": 2,
"panther": 1,
"prosite": 1,
"interpro": 5
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 58034
}
}
}