GET /api/protein/UniProt/A5I6W5/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A5I6W5",
        "id": "PYRE_CLOBH",
        "source_organism": {
            "taxId": "441771",
            "scientificName": "Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A)",
            "fullName": "Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A)"
        },
        "name": "Orotate phosphoribosyltransferase",
        "description": [
            "Catalyzes the transfer of a ribosyl phosphate group from 5-phosphoribose 1-diphosphate to orotate, leading to the formation of orotidine monophosphate (OMP)"
        ],
        "length": 191,
        "sequence": "MSNINVIDILKESDALLEGHFLLSSGRHSNRYCQCAKLLQCPQKAEKVISVIAEKLKEVDFNIIVGPAMGGVIVSYELARQTNKPGIFAERKEGVMCIRRGFEIKKGDKVIISEDVVTTGKSSLEVAKVIEEMGGEVVGIACIVDRRAEDIKTNYPIYSACKLEIETYEKDNCELCKKNIPFVKPGSREQK",
        "proteome": "UP000001986",
        "gene": "pyrE",
        "go_terms": [
            {
                "identifier": "GO:0004588",
                "name": "orotate phosphoribosyltransferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006221",
                "name": "pyrimidine nucleotide biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0019856",
                "name": "pyrimidine nucleobase biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "0f8ac38f062a402c09070bf5cbec330fb03fbefd",
        "counters": {
            "domain_architectures": 136430,
            "entries": 11,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "pfam": 1,
                "cdd": 1,
                "hamap": 1,
                "panther": 1,
                "ncbifam": 1,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 136430
        }
    }
}