GET /api/protein/UniProt/A5HY53/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A5HY53",
        "id": "ATPE_CLOBH",
        "source_organism": {
            "taxId": "441771",
            "scientificName": "Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A)",
            "fullName": "Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A)"
        },
        "name": "ATP synthase epsilon chain",
        "description": [
            "Produces ATP from ADP in the presence of a proton gradient across the membrane"
        ],
        "length": 133,
        "sequence": "MKDNIELTIFTPEKNIKIGEIKEVITEGLDGDLAILPNHVNMITYLKPTITKYIDLNGNKNNIFTSSGVLKVEDNKVYIICDASEKPEDIDIKRAENARKRAEERLRNKKEIDVKRAELALFRSIARIKIKEL",
        "proteome": "UP000001986",
        "gene": "atpC",
        "go_terms": [
            {
                "identifier": "GO:0046933",
                "name": "proton-transporting ATP synthase activity, rotational mechanism",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0015986",
                "name": "proton motive force-driven ATP synthesis",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0045259",
                "name": "proton-transporting ATP synthase complex",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "6376a3906ef3eefc3872d0227b1dc6d17ed462fe",
        "counters": {
            "domain_architectures": 24339,
            "entries": 16,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 2,
                "cathgene3d": 2,
                "cdd": 1,
                "pfam": 2,
                "ncbifam": 2,
                "hamap": 1,
                "panther": 1,
                "interpro": 5
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 24339
        }
    }
}