HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A5GAV7",
"id": "RL6_GEOUR",
"source_organism": {
"taxId": "351605",
"scientificName": "Geotalea uraniireducens (strain Rf4)",
"fullName": "Geotalea uraniireducens (strain Rf4)"
},
"name": "Large ribosomal subunit protein uL6",
"description": [
"This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center"
],
"length": 179,
"sequence": "MSRIGKLPIEIPKGVKISYIDSNLMVEGPKGSLGRRIMSGVSIDLTDNTITVSRDNDGIKSRSAHGLTRTLINNMVTGVTTGFETALEINGVGYRAELKGDVLNLSLGYSHPINFQLPKGINVEVDKMTKLLVKGIDKELVGQTAAKIRAFRGPEPYKGKGVKYANETILRKAGKTGKK",
"proteome": "UP000006695",
"gene": "rplF",
"go_terms": [
{
"identifier": "GO:0003735",
"name": "structural constituent of ribosome",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0019843",
"name": "rRNA binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006412",
"name": "translation",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0005840",
"name": "ribosome",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "c01b5e597917fe4c7fa771044375a52b35f2e850",
"counters": {
"domain_architectures": 32310,
"entries": 14,
"isoforms": 0,
"proteomes": 1,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"cathgene3d": 1,
"pfam": 1,
"panther": 1,
"pirsf": 1,
"hamap": 1,
"ncbifam": 1,
"prints": 1,
"prosite": 1,
"interpro": 5
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 32310
}
}
}