GET /api/protein/UniProt/A5BY21/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A5BY21",
        "id": "A5BY21_VITVI",
        "source_organism": {
            "taxId": "29760",
            "scientificName": "Vitis vinifera",
            "fullName": "Vitis vinifera (Grape)"
        },
        "name": "Uncharacterized protein",
        "description": [
            "Involved in sequestration of excess metal in the cytoplasm into vacuoles to maintain metal homeostasis"
        ],
        "length": 403,
        "sequence": "MDPVKTPLLSTKGEKPNQHERIRGRDSVTALKRDFFSQLPEKIRSQLDPETPFELDLSKTNGLVEGEXEYYEKQFATLRSFEEVDSLASSHVTSEEQDREQQTQHERAMKTSNWANIFLLVFKIYATVRSGSLAIAASTLDSXLDLLAGGILWFXHLSMKNINIYKYPIGKLRVQPVGIIXFAAVMATXGFLVLIQAVEELIKNEPSEKMTSEKLVWLYAIMLTATVVKLALWFYCRSSGNKIVRAYAKDHYFDVITNIVGLVAAVLGDKFFWWIDPVGAIILAVYTISNWSRTVLDNAVSLVGQSASPEVLQKLTYLVIRHDPKIKRVDTVRAYTFGALHFVEVDIELPEDLPLKEAHAIGESLQIKIEELLEVERAFVHLDFECDHKPEHSVPSKIPNSPR",
        "proteome": null,
        "gene": "VITISV_031492",
        "go_terms": [
            {
                "identifier": "GO:0008324",
                "name": "monoatomic cation transmembrane transporter activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006812",
                "name": "monoatomic cation transport",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0055085",
                "name": "transmembrane transport",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0016020",
                "name": "membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 4,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": false,
        "in_bfvd": false,
        "ida_accession": "b102d6e427d8516f3007f76e7d0e9c0b51265ff5",
        "counters": {
            "domain_architectures": 59537,
            "entries": 14,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 2,
                "cathgene3d": 2,
                "pfam": 2,
                "panther": 1,
                "ncbifam": 1,
                "interpro": 6
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 59537
        }
    }
}