HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A5BY21",
"id": "A5BY21_VITVI",
"source_organism": {
"taxId": "29760",
"scientificName": "Vitis vinifera",
"fullName": "Vitis vinifera (Grape)"
},
"name": "Uncharacterized protein",
"description": [
"Involved in sequestration of excess metal in the cytoplasm into vacuoles to maintain metal homeostasis"
],
"length": 403,
"sequence": "MDPVKTPLLSTKGEKPNQHERIRGRDSVTALKRDFFSQLPEKIRSQLDPETPFELDLSKTNGLVEGEXEYYEKQFATLRSFEEVDSLASSHVTSEEQDREQQTQHERAMKTSNWANIFLLVFKIYATVRSGSLAIAASTLDSXLDLLAGGILWFXHLSMKNINIYKYPIGKLRVQPVGIIXFAAVMATXGFLVLIQAVEELIKNEPSEKMTSEKLVWLYAIMLTATVVKLALWFYCRSSGNKIVRAYAKDHYFDVITNIVGLVAAVLGDKFFWWIDPVGAIILAVYTISNWSRTVLDNAVSLVGQSASPEVLQKLTYLVIRHDPKIKRVDTVRAYTFGALHFVEVDIELPEDLPLKEAHAIGESLQIKIEELLEVERAFVHLDFECDHKPEHSVPSKIPNSPR",
"proteome": null,
"gene": "VITISV_031492",
"go_terms": [
{
"identifier": "GO:0008324",
"name": "monoatomic cation transmembrane transporter activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006812",
"name": "monoatomic cation transport",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0055085",
"name": "transmembrane transport",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0016020",
"name": "membrane",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 4,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": false,
"in_bfvd": false,
"ida_accession": "b102d6e427d8516f3007f76e7d0e9c0b51265ff5",
"counters": {
"domain_architectures": 59537,
"entries": 14,
"isoforms": 0,
"proteomes": 0,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 2,
"cathgene3d": 2,
"pfam": 2,
"panther": 1,
"ncbifam": 1,
"interpro": 6
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 59537
}
}
}