GET /api/protein/UniProt/A5BM26/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A5BM26",
"id": "A5BM26_VITVI",
"source_organism": {
"taxId": "29760",
"scientificName": "Vitis vinifera",
"fullName": "Vitis vinifera (Grape)"
},
"name": "DNA-directed RNA polymerase subunit",
"description": [
"DNA-dependent RNA polymerase which catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates"
],
"length": 177,
"sequence": "MFLKVQLPWNVIIPAECLDAKGLMLQRSIIIRLLDAFSNKKATQELGYFLAVTTLENIGEGKVRQHSGDVLFPVVFSCVTFKLFRGEILDGVVHKVLKHGVILRCGPVENIYLSCQKMPDYRYVPGENPVFLNEKLSKIEKDVVVRFIVMGTKWLEAEREFQALVSLEGDYLGPLSD",
"proteome": null,
"gene": "VITISV_043525",
"go_terms": [
{
"identifier": "GO:0006352",
"name": "DNA-templated transcription initiation",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": null,
"counters": {
"domain_architectures": 0,
"entries": 9,
"isoforms": 0,
"proteomes": 0,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 2,
"cathgene3d": 2,
"cdd": 1,
"panther": 1,
"interpro": 3
},
"proteome": 0,
"taxonomy": 1
}
}
}