General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A5BDM1",
        "id": "A5BDM1_VITVI",
        "source_organism": {
            "taxId": "29760",
            "scientificName": "Vitis vinifera",
            "fullName": "Vitis vinifera (Grape)"
        },
        "name": "gibberellin 2beta-dioxygenase",
        "description": [
            "Catalyzes the 2-beta-hydroxylation of several biologically active gibberellins, leading to the homeostatic regulation of their endogenous level. Catabolism of gibberellins (GAs) plays a central role in plant development. Converts GA9/GA20 to GA51/GA29 and GA4/GA1 to GA34/GA8"
        ],
        "length": 323,
        "sequence": "MGVFSKPAIEQLPLIRNCMPFSGIPLIDLSQPDSKALLIEACQEFGFFKVINHGVPMDLISKLEAEAVNFFSLPLSEKEKAGPPNPSGYGNKRIGSSGDIGRVEYLLLNPQSFPSVFGQNPDMFRSAVSDYLSAVRKMACEILELLADGLMIQPRNVFSKLLMDEQSDSVFRLNHYPPYPERQALSGKCMIGFGEHTDPQIISVLRSNNTSGLQISLRNGNWISVPPDENSFFINVGDSLQVMTNGRFQSVKHRVLTNSCKSRVSMIYFGGPPLSEKIAPLPSLMEGEESHYKEFTWFEYKRSAYNTRLADNRLVFFQKVAAT",
        "proteome": null,
        "gene": "VITISV_044416",
        "go_terms": null,
        "protein_evidence": 2,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "dba0199fa67b925969a474f1e6e1a81dee82ff76",
        "counters": {
            "domain_architectures": 86072,
            "entries": 8,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "pfam": 2,
                "panther": 1,
                "interpro": 3
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 86072
        }
    }
}