GET /api/protein/UniProt/A5BDM1/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A5BDM1",
"id": "A5BDM1_VITVI",
"source_organism": {
"taxId": "29760",
"scientificName": "Vitis vinifera",
"fullName": "Vitis vinifera (Grape)"
},
"name": "gibberellin 2beta-dioxygenase",
"description": [
"Catalyzes the 2-beta-hydroxylation of several biologically active gibberellins, leading to the homeostatic regulation of their endogenous level. Catabolism of gibberellins (GAs) plays a central role in plant development. Converts GA9/GA20 to GA51/GA29 and GA4/GA1 to GA34/GA8"
],
"length": 323,
"sequence": "MGVFSKPAIEQLPLIRNCMPFSGIPLIDLSQPDSKALLIEACQEFGFFKVINHGVPMDLISKLEAEAVNFFSLPLSEKEKAGPPNPSGYGNKRIGSSGDIGRVEYLLLNPQSFPSVFGQNPDMFRSAVSDYLSAVRKMACEILELLADGLMIQPRNVFSKLLMDEQSDSVFRLNHYPPYPERQALSGKCMIGFGEHTDPQIISVLRSNNTSGLQISLRNGNWISVPPDENSFFINVGDSLQVMTNGRFQSVKHRVLTNSCKSRVSMIYFGGPPLSEKIAPLPSLMEGEESHYKEFTWFEYKRSAYNTRLADNRLVFFQKVAAT",
"proteome": null,
"gene": "VITISV_044416",
"go_terms": null,
"protein_evidence": 2,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "dba0199fa67b925969a474f1e6e1a81dee82ff76",
"counters": {
"domain_architectures": 86072,
"entries": 8,
"isoforms": 0,
"proteomes": 0,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"pfam": 2,
"panther": 1,
"interpro": 3
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 86072
}
}
}