GET /api/protein/UniProt/A4YE31/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A4YE31",
"id": "A4YE31_METS5",
"source_organism": {
"taxId": "399549",
"scientificName": "Metallosphaera sedula (strain ATCC 51363 / DSM 5348 / JCM 9185 / NBRC 15509 / TH2)",
"fullName": "Metallosphaera sedula (strain ATCC 51363 / DSM 5348 / JCM 9185 / NBRC 15509 / TH2)"
},
"name": "4Fe-4S ferredoxin-type domain-containing protein",
"description": null,
"length": 88,
"sequence": "MIKVPADIPLARPTLGSAGKTGTWRVLKPVIHYDKCTRCRLCFFYCVENTIDLEKNLYPRIDYDYCKGCGVCAQVCPTAAIEMIKEVK",
"proteome": "UP000000242",
"gene": "Msed_0508",
"go_terms": [
{
"identifier": "GO:0016625",
"name": "oxidoreductase activity, acting on the aldehyde or oxo group of donors, iron-sulfur protein as acceptor",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0051539",
"name": "4 iron, 4 sulfur cluster binding",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 4,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "50f692799a4aac31f6710e3d85c099934fdbb2f6",
"counters": {
"domain_architectures": 13962,
"entries": 10,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"profile": 1,
"pfam": 1,
"panther": 1,
"ncbifam": 1,
"prosite": 1,
"interpro": 3
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 13962
}
}
}