GET /api/protein/UniProt/A4YCB3/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A4YCB3",
"id": "A4YCB3_SHEPC",
"source_organism": {
"taxId": "319224",
"scientificName": "Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)",
"fullName": "Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)"
},
"name": "dTDP-4-dehydrorhamnose 3,5-epimerase",
"description": [
"Catalyzes the epimerization of the C3' and C5'positions of dTDP-6-deoxy-D-xylo-4-hexulose, forming dTDP-6-deoxy-L-lyxo-4-hexulose"
],
"length": 181,
"sequence": "MNIIDTKIADVKIIEPKVFGDERGFFFESFNQQQFEAAIGRQVQFVQDNHSKSSKGVLRGLHYQGSPHAQAKLVRCVVGEVFDVVVDIRKNSSTFGEWLGVSLTAENKRQLWIPQGFAHGFLTLSDTAECLYKTTDYYHQASEGAIRWDDPQLNIQWPIKSPLLSLKDQQAQTFLDFKRLL",
"proteome": null,
"gene": "Sputcn32_3890",
"go_terms": [
{
"identifier": "GO:0008830",
"name": "dTDP-4-dehydrorhamnose 3,5-epimerase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "e2d3e4b29ab4508e19970c2d2c3c84be07611adf",
"counters": {
"domain_architectures": 25044,
"entries": 9,
"isoforms": 0,
"proteomes": 0,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"cathgene3d": 1,
"cdd": 1,
"pfam": 1,
"ncbifam": 1,
"panther": 1,
"interpro": 3
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 25044
}
}
}