GET /api/protein/UniProt/A4WQ06/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A4WQ06",
"id": "A4WQ06_CERS5",
"source_organism": {
"taxId": "349102",
"scientificName": "Cereibacter sphaeroides (strain ATCC 17025 / ATH 2.4.3)",
"fullName": "Cereibacter sphaeroides (strain ATCC 17025 / ATH 2.4.3)"
},
"name": "Cell division coordinator CpoB",
"description": [
"Mediates coordination of peptidoglycan synthesis and outer membrane constriction during cell division"
],
"length": 274,
"sequence": "MRTLILVAALALAPLPAAAQDRAQTLADIKAELSTLQAQFNDLKRELVSTGAATSGAAGGSALQRMDAMEAALSQVTAKAEALELKINRVVSDGTNRVGDLEFRVCELEDGCDIGALGETAPLGGQASAAPVATPAPAPAADPAGTFAVNEKADFDRAQEVLGQGDFRSAADLFKAFAETYTGGQLTYEAHYLRGEALRQLGETANAARAYLESFSGDPDGPRAPEALLKLGRALGDLRQTPEACVTLAEVGTRFPGSPSAAEAATAMQGLGCN",
"proteome": null,
"gene": "cpoB",
"go_terms": [
{
"identifier": "GO:0005515",
"name": "protein binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0051301",
"name": "cell division",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "2ae9decb7c3d550e3f8b8add4ffdfee743c9952d",
"counters": {
"domain_architectures": 2850,
"entries": 10,
"isoforms": 0,
"proteomes": 0,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"pfam": 2,
"hamap": 1,
"ncbifam": 1,
"interpro": 4
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 2850
}
}
}