GET /api/protein/UniProt/A4W7D6/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A4W7D6",
"id": "IMAND_ENT38",
"source_organism": {
"taxId": "399742",
"scientificName": "Enterobacter sp. (strain 638)",
"fullName": "Enterobacter sp. (strain 638)"
},
"name": "D-galactonate dehydratase family member Ent638_0932",
"description": [
"Has no detectable activity with D-mannonate and with a panel of 70 other acid sugars (in vitro), in spite of the conservation of the residues that are expected to be important for catalytic activity and cofactor binding. May have evolved a divergent function"
],
"length": 399,
"sequence": "MTPVIIKNIECFITRPDRHNLVTVRVTTEQGITGHGCATFQQRPLAVKTLVDEYLQPLMIGRDANNIEDLWQMMNVNAYWRNGPLMNNAISGVDMALWDIKGQLAGMPLYQLFGGKSRDAIPAYSHASGETLEALFASVDALIAQGYRHIRCQLGFYGGTPSALHAPDNPTPGAWFDQQEYMSNTVEMFHALREKYGWKLHILHDVHERLFPQQAVQLAKQLEPFQPYFIEDILPPQQSAWLEQVRQQSCVPLALGELFNNPAEWHDLIVNRRIDFIRCHVSQIGGITPALKLAHLCQAFGVRLAWHGPGDMTPIGVAVNTHLNIHLHNAAIQEFIPRSATTNDVFPGAPEVKEGFVYPPVQPGIGVGFNEALALAHPVLYRPHEWTQSRLPDGTIHTP",
"proteome": "UP000000230",
"gene": "Ent638_0932",
"go_terms": [
{
"identifier": "GO:0009063",
"name": "amino acid catabolic process",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 1,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "7cfc8a278749371baa841e828fd88478f80be1a3",
"counters": {
"domain_architectures": 70236,
"entries": 18,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 1,
"taxa": 1,
"dbEntries": {
"cathgene3d": 2,
"ssf": 2,
"pfam": 2,
"smart": 1,
"sfld": 2,
"panther": 1,
"prosite": 1,
"interpro": 7
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 70236
}
}
}