HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A4RQN4",
"id": "A4RQN4_OSTLU",
"source_organism": {
"taxId": "436017",
"scientificName": "Ostreococcus lucimarinus (strain CCE9901)",
"fullName": "Ostreococcus lucimarinus (strain CCE9901)"
},
"name": "Actin-related protein 2/3 complex subunit 4",
"description": [
"Functions as actin-binding component of the Arp2/3 complex which is involved in regulation of actin polymerization and together with an activating nucleation-promoting factor (NPF) mediates the formation of branched actin networks. Seems to contact the mother actin filament"
],
"length": 171,
"sequence": "MATSHRDYHDAVRAALEDAFALRSAPSKKMSGENRAEVEYADAPSLLMPSAEITRGCAEDGACLIERAVNSARVSVRVRQCDELEEILARAFCKSLGRRADAFEVLRRAPVEGYDVSFLVLLAHAERMEAKGLVDFVVTFMEDVDKEISEQKLSVSSRGRTVAAAYLRQFA",
"proteome": "UP000001568",
"gene": "OSTLU_86040",
"go_terms": [
{
"identifier": "GO:0030041",
"name": "actin filament polymerization",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0034314",
"name": "Arp2/3 complex-mediated actin nucleation",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0005885",
"name": "Arp2/3 protein complex",
"category": {
"code": "C",
"name": "cellular_component"
}
},
{
"identifier": "GO:0015629",
"name": "actin cytoskeleton",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "ba4bd2f320827d1e2de4d2fc89b584ec7cb30ead",
"counters": {
"domain_architectures": 5289,
"entries": 7,
"isoforms": 0,
"proteomes": 1,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"pfam": 1,
"panther": 1,
"pirsf": 1,
"interpro": 2
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 5289
}
}
}