GET /api/protein/UniProt/A4PDW6/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A4PDW6",
        "id": "A4PDW6_BALED",
        "source_organism": {
            "taxId": "9769",
            "scientificName": "Balaenoptera edeni",
            "fullName": "Balaenoptera edeni (Pigmy Bryde's whale)"
        },
        "name": "Sex-determining region Y protein",
        "description": [
            "Transcriptional regulator that controls a genetic switch in male development. It is necessary and sufficient for initiating male sex determination by directing the development of supporting cell precursors (pre-Sertoli cells) as Sertoli rather than granulosa cells. Involved in different aspects of gene regulation including promoter activation or repression. Binds to the DNA consensus sequence 5'-[AT]AACAA[AT]-3'. SRY HMG box recognizes DNA by partial intercalation in the minor groove and promotes DNA bending. Also involved in pre-mRNA splicing. In male adult brain involved in the maintenance of motor functions of dopaminergic neurons"
        ],
        "length": 204,
        "sequence": "MFRIVNGEDYSPAVQQRNSLDFGKAPSLLWTDNGGSNDRCETGGNGRESGQDRVKRPMNAFIVWSRDQRRKVALENPQMQNSEISKRLGYDWKMLTEAEKQPFFEEAQRLRAMHRDKYPGYKYRPRRKAKRPQKLLPADSSVLCSRMHIEETLYPFTYKDGCAKATRSRMESRLSHSQPTNTTSSLLPQEHRSSWTSLSHNRVT",
        "proteome": null,
        "gene": "SRY",
        "go_terms": [
            {
                "identifier": "GO:0003677",
                "name": "DNA binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0003700",
                "name": "DNA-binding transcription factor activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0030238",
                "name": "male sex determination",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005634",
                "name": "nucleus",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "ba71805ac3750d134530e8b8d14e816f9d4dbece",
        "counters": {
            "domain_architectures": 54587,
            "entries": 12,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "cdd": 1,
                "ssf": 1,
                "smart": 1,
                "profile": 1,
                "pfam": 1,
                "pirsf": 1,
                "panther": 1,
                "interpro": 4
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 54587
        }
    }
}