General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A4GD81",
        "id": "A4GD81_VACCL",
        "source_organism": {
            "taxId": "10252",
            "scientificName": "Vaccinia virus (strain Lister)",
            "fullName": "Vaccinia virus (strain Lister) (VACV)"
        },
        "name": "Complement control protein C3",
        "description": [
            "Serves to protect the virus against complement attack by inhibiting both classical and alternative pathways of complement activation. Binds C3b and C4b"
        ],
        "length": 263,
        "sequence": "MKVESVTFLTLLGIGCVLSCCTIPSRPINMKFKNSVETDANANYNIGDTIEYLCLPGYRKQKMGPIYAKCTGTGWTLFNQCIKRRCPSPRDIDNGQLDIGGVDFGSSITYSCNSGYHLIGESKSYCELGSTGSMVWNPEAPICESVKCQSPPSISNGRHNGYEDFYTDGSVVTYSCNSGYSLIGNSGVLCSGGEWSDPPTCQIVKCPHPTISNGYLSSGFKRSYSYNDNVDFKCKYGYKLSGSSSSTCSPGNTWKPELPKCVR",
        "proteome": null,
        "gene": "List022",
        "go_terms": [
            {
                "identifier": "GO:0001848",
                "name": "complement binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0045916",
                "name": "negative regulation of complement activation",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0016020",
                "name": "membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": false,
        "in_bfvd": false,
        "ida_accession": "f816ba9c1e4de4008bb41c472fa35ccdd867f627",
        "counters": {
            "domain_architectures": 4391,
            "entries": 13,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "profile": 2,
                "ssf": 1,
                "cathgene3d": 1,
                "cdd": 1,
                "smart": 1,
                "pfam": 1,
                "pirsf": 1,
                "panther": 1,
                "interpro": 4
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 4391
        }
    }
}