HTTP 200 OK
Allow: GET, HEAD
Cached: true
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Server-Timing:
Vary: Accept
{
"metadata": {
"accession": "A3PQJ2",
"id": "PROA_CERS1",
"source_organism": {
"taxId": "349101",
"scientificName": "Cereibacter sphaeroides (strain ATCC 17029 / ATH 2.4.9)",
"fullName": "Cereibacter sphaeroides (strain ATCC 17029 / ATH 2.4.9)"
},
"name": "Gamma-glutamyl phosphate reductase",
"description": [
"Catalyzes the NADPH-dependent reduction of L-glutamate 5-phosphate into L-glutamate 5-semialdehyde and phosphate. The product spontaneously undergoes cyclization to form 1-pyrroline-5-carboxylate"
],
"length": 420,
"sequence": "MDGTDVTMLMREIGVRARAAAAELAFAEPSRKEEALNAAAEAMLARSDEILEANGRDLAFGAEKGLTPAMMDRLKLDAARIDGIVEGLRAVAGQPDPVGQVIAEWDRPSGLHIRRVRTPLGVVGVIYESRPNVTADAGALCLKSGNAVILRGGSESFHSSGAIHAALQDGLRQAGLPVDAIQRVPTRDRAAVAEMLRMVEHIDVIVPRGGKGLVGLVQAEARVPVFAHLEGICHVYADGDADLEKARRVVLNAKTRRTGICGSAECLLIDRAFLAKHGPVLIEDLLKAGVEVRAEGELAQVPGTVPAQPEDFGREFLDMIIAAKVVDGVDEAIAHIRRYGSSHTESILTENDATAERFFRRLDSAILMRNASTQFADGGEFGMGAEIGIATGKMHARGPVGAEQLTSFKYLVTGDGTIRA",
"proteome": null,
"gene": "proA",
"go_terms": [
{
"identifier": "GO:0016491",
"name": "oxidoreductase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0004350",
"name": "glutamate-5-semialdehyde dehydrogenase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0055129",
"name": "L-proline biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0050661",
"name": "NADP binding",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "dd09ddecf5caaba5fcfea9e2a4f53107ee48a6df",
"counters": {
"domain_architectures": 359073,
"entries": 18,
"isoforms": 0,
"proteomes": 0,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"cathgene3d": 2,
"cdd": 1,
"ncbifam": 2,
"pirsf": 1,
"panther": 1,
"hamap": 1,
"pfam": 1,
"prosite": 1,
"interpro": 7
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 359073
}
}
}