GET /api/protein/UniProt/A3PQJ2/?format=api
HTTP 200 OK
Allow: GET, HEAD
Cached: true
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Server-Timing: 
Vary: Accept

{
    "metadata": {
        "accession": "A3PQJ2",
        "id": "PROA_CERS1",
        "source_organism": {
            "taxId": "349101",
            "scientificName": "Cereibacter sphaeroides (strain ATCC 17029 / ATH 2.4.9)",
            "fullName": "Cereibacter sphaeroides (strain ATCC 17029 / ATH 2.4.9)"
        },
        "name": "Gamma-glutamyl phosphate reductase",
        "description": [
            "Catalyzes the NADPH-dependent reduction of L-glutamate 5-phosphate into L-glutamate 5-semialdehyde and phosphate. The product spontaneously undergoes cyclization to form 1-pyrroline-5-carboxylate"
        ],
        "length": 420,
        "sequence": "MDGTDVTMLMREIGVRARAAAAELAFAEPSRKEEALNAAAEAMLARSDEILEANGRDLAFGAEKGLTPAMMDRLKLDAARIDGIVEGLRAVAGQPDPVGQVIAEWDRPSGLHIRRVRTPLGVVGVIYESRPNVTADAGALCLKSGNAVILRGGSESFHSSGAIHAALQDGLRQAGLPVDAIQRVPTRDRAAVAEMLRMVEHIDVIVPRGGKGLVGLVQAEARVPVFAHLEGICHVYADGDADLEKARRVVLNAKTRRTGICGSAECLLIDRAFLAKHGPVLIEDLLKAGVEVRAEGELAQVPGTVPAQPEDFGREFLDMIIAAKVVDGVDEAIAHIRRYGSSHTESILTENDATAERFFRRLDSAILMRNASTQFADGGEFGMGAEIGIATGKMHARGPVGAEQLTSFKYLVTGDGTIRA",
        "proteome": null,
        "gene": "proA",
        "go_terms": [
            {
                "identifier": "GO:0016491",
                "name": "oxidoreductase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0004350",
                "name": "glutamate-5-semialdehyde dehydrogenase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0055129",
                "name": "L-proline biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0050661",
                "name": "NADP binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "dd09ddecf5caaba5fcfea9e2a4f53107ee48a6df",
        "counters": {
            "domain_architectures": 359073,
            "entries": 18,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "cathgene3d": 2,
                "cdd": 1,
                "ncbifam": 2,
                "pirsf": 1,
                "panther": 1,
                "hamap": 1,
                "pfam": 1,
                "prosite": 1,
                "interpro": 7
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 359073
        }
    }
}