HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A3P0E5",
"id": "A3P0E5_BURP0",
"source_organism": {
"taxId": "357348",
"scientificName": "Burkholderia pseudomallei (strain 1106a)",
"fullName": "Burkholderia pseudomallei (strain 1106a)"
},
"name": "VOC domain-containing protein",
"description": null,
"length": 365,
"sequence": "MQIPTWDNPVGTDGFEFIEYTAPDPKALGQLFERMGFTAVARHRHKDVTLYRQGDINFIINAEPDSFAQRFARLHGPSICAIAFRVQDAAKAYRHALELGAWGFDNKTGPMELNIPAIKGIGDSLIYFVDRWRGKNGAKPGAIGDISIYDVDFEPIPGADPNPAGHGLTYIDHLTHNVHRGRMQEWAEFYERLFNFREVRYFDIEGKVTGVKSKAMTSPCGKIRIPINEEGSDTAGQIQEYLDAYRGEGIQHIALGAADIYRAVDGLRAKGVTLLDTIDTYYELVDRRVPNHGEPLDELRKRKILIDGAHDDLLLQIFTENQIGPIFFEIIQRKGNQGFGEGNFKALFESIELDQIRRGVVQDKA",
"proteome": null,
"gene": "hppD",
"go_terms": [
{
"identifier": "GO:0003868",
"name": "4-hydroxyphenylpyruvate dioxygenase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0016701",
"name": "oxidoreductase activity, acting on single donors with incorporation of molecular oxygen",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0009072",
"name": "aromatic amino acid metabolic process",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "32608492e6ba0fbefc9f10c96738c82a206ad368",
"counters": {
"domain_architectures": 7265,
"entries": 16,
"isoforms": 0,
"proteomes": 0,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"cathgene3d": 1,
"pfam": 2,
"profile": 1,
"cdd": 2,
"pirsf": 1,
"panther": 1,
"ncbifam": 1,
"interpro": 6
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 7265
}
}
}