General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A3MZ80",
        "id": "UNG_ACTP2",
        "source_organism": {
            "taxId": "416269",
            "scientificName": "Actinobacillus pleuropneumoniae serotype 5b (strain L20)",
            "fullName": "Actinobacillus pleuropneumoniae serotype 5b (strain L20)"
        },
        "name": "Uracil-DNA glycosylase",
        "description": [
            "Excises uracil residues from the DNA which can arise as a result of misincorporation of dUMP residues by DNA polymerase or due to deamination of cytosine"
        ],
        "length": 225,
        "sequence": "MNNWTEALGEEKQQPYFQHILQQVHQERMNGVTVFPPQKEVFSAFALTEFKDVKVVILGQDPYHGPNQAHGLAFSVKPPVAPPPSLVNMYKELAQDVEGFQIPNHGYLVDWAKQGVLLLNTVLTVRQGQAHSHANFGWEIFTDKVIAQLNQHRENLVFLLWGSHAQKKGQFIDRSRHCVLTAPHPSPLSAYRGFFGCKHFSKTNRYLLSKGIAPINWQLRLEIDY",
        "proteome": null,
        "gene": "ung",
        "go_terms": [
            {
                "identifier": "GO:0004844",
                "name": "uracil DNA N-glycosylase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006281",
                "name": "DNA repair",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0006284",
                "name": "base-excision repair",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0016799",
                "name": "hydrolase activity, hydrolyzing N-glycosyl compounds",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "6d3eb109c1e174cd82c598bd72ab8f3ce4283767",
        "counters": {
            "domain_architectures": 69726,
            "entries": 18,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "cdd": 1,
                "smart": 2,
                "pfam": 1,
                "hamap": 1,
                "ncbifam": 5,
                "panther": 1,
                "prosite": 1,
                "interpro": 4
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 69726
        }
    }
}