General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A3KNL6",
        "id": "GGACC_DANRE",
        "source_organism": {
            "taxId": "7955",
            "scientificName": "Danio rerio",
            "fullName": "Danio rerio (Zebrafish)"
        },
        "name": "Gamma-glutamylaminecyclotransferase C",
        "description": [
            "May contribute to degradation of proteins cross-linked by transglutaminases by degrading the cross-link between a lysine and a glutamic acid residue. Catalyzes the formation of 5-oxo-L-proline from L-gamma-glutamyl-L-epsilon-lysine"
        ],
        "length": 152,
        "sequence": "MSTHHVFVYGSLKKGQPNHHELLNSNNGQAEFITCAQTKEPYPLVIATKHNIPFLLNVPGSGKQVSGEIYSVDQKMLEFLDWFEKCPDWYQRTSIQLEILKGNGESGRIEEASVYSKINFEPDWLNKPTHESYDTNGDHGLKFVCREDRKDD",
        "proteome": "UP000000437",
        "gene": "ggact.3",
        "go_terms": [
            {
                "identifier": "GO:0061929",
                "name": "gamma-glutamylaminecyclotransferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 2,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "8e309f4489580bca6e10fde9c1906d455f235b11",
        "counters": {
            "domain_architectures": 18652,
            "entries": 9,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "cdd": 1,
                "panther": 1,
                "pfam": 1,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 18652
        }
    }
}