HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A3KN12",
"id": "PUR8_BOVIN",
"source_organism": {
"taxId": "9913",
"scientificName": "Bos taurus",
"fullName": "Bos taurus (Bovine)"
},
"name": "Adenylosuccinate lyase",
"description": [
"Catalyzes two non-sequential steps in de novo AMP synthesis: converts (S)-2-(5-amino-1-(5-phospho-D-ribosyl)imidazole-4-carboxamido)succinate (SAICAR) to fumarate plus 5-amino-1-(5-phospho-D-ribosyl)imidazole-4-carboxamide, and thereby also contributes to de novo IMP synthesis, and converts succinyladenosine monophosphate (SAMP) to AMP and fumarate"
],
"length": 490,
"sequence": "MAAAGDRGGREAACGHDSYRSPLASRYASPEMCFLFSDKYKFRTWRQLWLWLAEAEQTLGLPITDEQIQEMKSNLDNIDFRMAAEEEKQLRHDVMAHVHTFAHCCPKAASIIHLGATSCYVGDNTDLIILRNAFDLLLPKLARVISRLADFAKEQADLPTLGFTHFQPAQLTTVGKRCCLWIQDLCMDLQNLKRVRDELRFRGVKGTTGTQASFLQLFEGDDQKVEQLDKMVTEKAGFKRAFIITGQTYTRKVDIEVLSVLASLGASVHKICTDIRLLANLKEMEEPFEKQQIGSSAMPYKRNPMRSERCCSLARHLMALVMDPLQTASVQWFERTLDDSANRRICLAEAFLTADTVLNTLQNISEGLVVYPKVIERRVQQELPFMATENIIMAMVKAGGNRQDCREKIRVLSQQAAAVVKQEGGDNDLIERIQADAYFSPIHSQLDHLLDPSSFTGRASQQVQRFLEEEVCPLLKPYESVMKVKAELRL",
"proteome": "UP000009136",
"gene": "ADSL",
"go_terms": [
{
"identifier": "GO:0003824",
"name": "catalytic activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0004018",
"name": "N6-(1,2-dicarboxyethyl)AMP AMP-lyase (fumarate-forming) activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0009152",
"name": "purine ribonucleotide biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 2,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "4aa296ce872e7f1f3b85130edf14bb8eaf8f3c83",
"counters": {
"domain_architectures": 23990,
"entries": 19,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"cdd": 1,
"cathgene3d": 3,
"pfam": 2,
"smart": 1,
"panther": 1,
"ncbifam": 1,
"prosite": 1,
"prints": 2,
"interpro": 6
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 23990
}
}
}