GET /api/protein/UniProt/A3DDL7/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A3DDL7",
"id": "A3DDL7_ACET2",
"source_organism": {
"taxId": "203119",
"scientificName": "Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372)",
"fullName": "Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372)"
},
"name": "Stage 0 sporulation protein A homolog",
"description": [
"May play the central regulatory role in sporulation. It may be an element of the effector pathway responsible for the activation of sporulation genes in response to nutritional stress. Spo0A may act in concert with spo0H (a sigma factor) to control the expression of some genes that are critical to the sporulation process"
],
"length": 117,
"sequence": "MKRILVVDDAGFMRASLKMMLERNGHQVVGEAENGLVAVTKYKEIRPDIVTMDITMPVCDGIKAVKMIKEFDPDAKVIMISSMGQECFVRDAILAGAKGFIVKPFKEDYVIQAIEKL",
"proteome": "UP000002145",
"gene": "Cthe_0811",
"go_terms": [
{
"identifier": "GO:0000160",
"name": "phosphorelay signal transduction system",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 4,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "2b3543d858b8ab91bbdca9e4d43b1a8c5763b553",
"counters": {
"domain_architectures": 192712,
"entries": 9,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"cathgene3d": 1,
"smart": 1,
"profile": 1,
"pfam": 1,
"panther": 1,
"interpro": 3
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 192712
}
}
}