General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A3CAN9",
        "id": "A3CAN9_ORYSJ",
        "source_organism": {
            "taxId": "39947",
            "scientificName": "Oryza sativa subsp. japonica",
            "fullName": "Oryza sativa subsp. japonica (Rice)"
        },
        "name": "Phospholipase A1 EG1, chloroplastic/mitochondrial",
        "description": [
            "Phospholipase that releases free fatty acids from phospholipids. Catalyzes the initial step of jasmonate (JA) biosynthesis. Required for the biosynthesis of endogenous JA in seedling, inflorescence and spikelets. Not essential for JA biosynthesis after wounding. Mediates spikelet development and specification of empty-glume identity. Functions in a high temperature-dependent manner to maintain floral developmental robustness under heat stress conditions. Functions by safeguarding the expression of several floral identity genes, such as MADS1, MADS6 and G1"
        ],
        "length": 460,
        "sequence": "MAIHLTNPPPGLYATKTPSQQQQQHRPAGSHAAAAAAATVAMPQTASAASSSVAVKKNMRQAAPVVVARRRTTAVESGGVALASVWREVQGERDWEGMVEGTAEEELHPLLRGEIVRYGELVAATYKAFDLDAASKRYLNCKYGKARMLDEVGMAGAGYEVTRYIYAAPDLAAGPPCPSRWIGYVAVATDEAVRRLGRRDIVVSFRGTVTGSEWVANMMSSLAPARFDPADPRPDVKVESGFLSVYTSDDATCRFTCGSCRNQLLSEVTRLIAKHKHEDVSVTLAGHSMGSSLALLLGYDLAELGLNRDARGRAVPITVFSFAGPRVGNTAFKDRCDELGVKVLRVVNVNDPITKLPGIFLNENSRVLGGKLELPWSSSCYTHVGVELALDFFKARDPACVHDLEAYLGLLKCPKVTKVMKEGEDLFSKAKKIVLEQSFDTWRWQMAAIQVGGLVQALGM",
        "proteome": null,
        "gene": "LOC_Os11g19340",
        "go_terms": [
            {
                "identifier": "GO:0006629",
                "name": "lipid metabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "fc928dcef83934fc9f01d159aae73bf9e479b9f4",
        "counters": {
            "domain_architectures": 46337,
            "entries": 7,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "cdd": 1,
                "ssf": 1,
                "pfam": 1,
                "panther": 1,
                "interpro": 2
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 46337
        }
    }
}