General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A2T9U7",
        "id": "A2T9U7_OSCCA",
        "source_organism": {
            "taxId": "386100",
            "scientificName": "Oscarella carmela",
            "fullName": "Oscarella carmela (Sponge)"
        },
        "name": "NADH-ubiquinone oxidoreductase chain 3",
        "description": [
            "Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) which catalyzes electron transfer from NADH through the respiratory chain, using ubiquinone as an electron acceptor. Essential for the catalytic activity of complex I"
        ],
        "length": 118,
        "sequence": "MSAEFYGVFIALCLSIVISVAISGASYILGVKQPDIEKVSVYECGFDPFESSRIPFSVRFFLIGILFLIFDXEISFLFPWSVVYNQISLFGYWTMIIFLFILTLGLIYEWMKGGLEWE",
        "proteome": null,
        "gene": "nad3",
        "go_terms": [
            {
                "identifier": "GO:0016651",
                "name": "oxidoreductase activity, acting on NAD(P)H",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0008137",
                "name": "NADH dehydrogenase (ubiquinone) activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": false,
        "in_bfvd": false,
        "ida_accession": "e9a5b42e32de65bd6bc464b4186c01128f5abeb7",
        "counters": {
            "domain_architectures": 65483,
            "entries": 7,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "hamap": 1,
                "panther": 1,
                "pfam": 1,
                "interpro": 3
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 65483
        }
    }
}