General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A2SQQ4",
        "id": "A2SQQ4_METLZ",
        "source_organism": {
            "taxId": "410358",
            "scientificName": "Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z)",
            "fullName": "Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z)"
        },
        "name": "Pyruvate/ketoisovalerate oxidoreductase catalytic domain-containing protein",
        "description": null,
        "length": 177,
        "sequence": "MKSEIRFSGLGGQGIITAAVILGRAAALYGSKHVVQTQSYGPEARGGASASAVIISDDPIYYPKVTDPDVYAIMSQEAYNKYGSNVREDAVMLLDPGYVTSRPSCRFFEVPATAEAKAQLGKTVFANVIMLGGILEATGIVSYDALEHAVLDSVPKGTEENNKRALAIGQELVRSQL",
        "proteome": "UP000000365",
        "gene": "Mlab_0486",
        "go_terms": [
            {
                "identifier": "GO:0016491",
                "name": "oxidoreductase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0016903",
                "name": "oxidoreductase activity, acting on the aldehyde or oxo group of donors",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 4,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "29fbddc08da1aa452e7151193ed1b99c9e09a163",
        "counters": {
            "domain_architectures": 9785,
            "entries": 7,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "pfam": 1,
                "panther": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 9785
        }
    }
}