GET /api/protein/UniProt/A2RV66/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A2RV66",
        "id": "SHSA1_XENLA",
        "source_organism": {
            "taxId": "8355",
            "scientificName": "Xenopus laevis",
            "fullName": "Xenopus laevis (African clawed frog)"
        },
        "name": "Protein shisa-1",
        "description": [
            "Required for head formation during gastrulation. Functions as an inhibitor for the caudalizing signals wnt and fgf, does not inhibit bmp, activin and nodal signaling in head formation process. Induces retention of fzd8 in the endoplasmic reticulum and inhibits trafficking of fzd8 to the cell surface"
        ],
        "length": 269,
        "sequence": "MEFIVLLTVCALLGLSCGQHGEYCHGWTDSYGIWRPGFQCPERYDPPEATFCCGSCGLKYCCSTVESRLDQGLCPNEEDLRDGVPSIELPPTVPTYFPFLLVGSIFVSFVILGSLVGLCCCKCLKPEDDTQVSGPAPIQSRLLDQDPSTDTSRHSSSSSASMPRPPIGARPQNLCSLGAENINLYMNMPPTFPMMGCPQNAQFMHPGTAGPSFMQPPFINYAVPAEHAIIMAPAPYIDARNCYGQTSNIYCQVPQQNDQTVCSGSPSKC",
        "proteome": "UP000186698",
        "gene": "shisa1",
        "go_terms": null,
        "protein_evidence": 2,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "4b739120faf2d02cba0e089bfdb5781f6a4aab90",
        "counters": {
            "domain_architectures": 7661,
            "entries": 4,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 1,
                "panther": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 7661
        }
    }
}