General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A2QPU0",
        "id": "A2QPU0_ASPNC",
        "source_organism": {
            "taxId": "425011",
            "scientificName": "Aspergillus niger (strain ATCC MYA-4892 / CBS 513.88 / FGSC A1513)",
            "fullName": "Aspergillus niger (strain ATCC MYA-4892 / CBS 513.88 / FGSC A1513)"
        },
        "name": "Cytochrome P450 phenylacetate hydroxylase",
        "description": null,
        "length": 517,
        "sequence": "MAIAAVLSFLQQSILESPLQSLAATAFIVPVLYIIINEFIRASARVSGLKGPRGLPLIGNLAQIRKNAAEQYRIWSRTHGPVYQIQLGNIPVVVVNSAAAAKVLFGHNAQALSSRPEFYTFHKIVSNTAGTTIGTSPYSESLKRRRKGAASALNRPSVESYISHLDVESRSFVDELYRYGNGGETPVDPMPMIQRLSLSLSLTLNWGVRVASQEEDLFAEITHVEEEISKFRSTTGNLQDYIPLLRLNPFNSNSKVAKEMRDRRDRYLTALNRDLDDRMKKGIHKPCIQANVILDKEAKLNSEELISISLTMLSGGLDTVTTLVAWSIGLLSQRPDIQEKAAKAIRDMYGHDQPLCDPMDDQRCAYVAALVRECLRYFTVLRLALPRTSIRDVVYNGTVIPKGTVFFLNSWACNMDPEVWSDPEEFRPERWLEQPDAPLFTYGMGYRMCAGSLLANRELYLVFMRTLNGFRIEPLGETDWHPVRGNSDPTSLVAIPKKYKVRFVPRDEKALAKALGR",
        "proteome": "UP000006706",
        "gene": "An08g00180",
        "go_terms": [
            {
                "identifier": "GO:0004497",
                "name": "monooxygenase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0005506",
                "name": "iron ion binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0016705",
                "name": "oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0020037",
                "name": "heme binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "a02e61ba6c64bb9a9c779746e03a6c43264a16fb",
        "counters": {
            "domain_architectures": 520850,
            "entries": 10,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "pfam": 1,
                "ssf": 1,
                "panther": 1,
                "prints": 2,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 520850
        }
    }
}