General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A2E4T4",
        "id": "A2E4T4_TRIV3",
        "source_organism": {
            "taxId": "412133",
            "scientificName": "Trichomonas vaginalis (strain ATCC PRA-98 / G3)",
            "fullName": "Trichomonas vaginalis (strain ATCC PRA-98 / G3)"
        },
        "name": "Small nuclear ribonucleoprotein Sm D1",
        "description": [
            "Essential for pre-mRNA splicing. Implicated in the formation of stable, biologically active snRNP structures"
        ],
        "length": 111,
        "sequence": "MKLVHFLRKLVRETVTVELKDNTVIKGTVVGVDSAMNTHLRLVHIKAPGQEEKRLENLTIRGASIRYVILPDVLNLDTLLVDDSPTKTRMRHGEAKEEKDRKPILFQQKKW",
        "proteome": "UP000001542",
        "gene": "TVAG_160790",
        "go_terms": [
            {
                "identifier": "GO:0003723",
                "name": "RNA binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0000387",
                "name": "spliceosomal snRNP assembly",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0006396",
                "name": "RNA processing",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "83b18cf71a575d59c0de6840812ffe7912383fc4",
        "counters": {
            "domain_architectures": 70645,
            "entries": 12,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "profile": 1,
                "cdd": 1,
                "ssf": 1,
                "smart": 1,
                "pfam": 1,
                "panther": 1,
                "interpro": 5
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 70645
        }
    }
}