GET /api/protein/UniProt/A1WWY9/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A1WWY9",
        "id": "ISPF_HALHL",
        "source_organism": {
            "taxId": "349124",
            "scientificName": "Halorhodospira halophila (strain DSM 244 / SL1)",
            "fullName": "Halorhodospira halophila (strain DSM 244 / SL1)"
        },
        "name": "2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase",
        "description": [
            "Involved in the biosynthesis of isopentenyl diphosphate (IPP) and dimethylallyl diphosphate (DMAPP), two major building blocks of isoprenoid compounds. Catalyzes the conversion of 4-diphosphocytidyl-2-C-methyl-D-erythritol 2-phosphate (CDP-ME2P) to 2-C-methyl-D-erythritol 2,4-cyclodiphosphate (ME-CPP) with a corresponding release of cytidine 5-monophosphate (CMP)"
        ],
        "length": 163,
        "sequence": "MIRIGQGFDVHRFAGKGEGFRLGGVAVPYHKRLEAHSDGDVLLHAITDGLLGACGMGDIGRHFPDDDPRWRDADSIGLLASTLRLAAEAGWVPVNVDGTVIAQAPKLAPYIGAMRQATADAMELSPGAVNVKATTSERLGFTGRGEGIAAMAVVLVESAPGRG",
        "proteome": "UP000000647",
        "gene": "ispF",
        "go_terms": [
            {
                "identifier": "GO:0008685",
                "name": "2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0016114",
                "name": "terpenoid biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "4806cfc55513dcfafc7c50c91b7c811c37f0503d",
        "counters": {
            "domain_architectures": 17724,
            "entries": 11,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "cathgene3d": 1,
                "cdd": 1,
                "pfam": 1,
                "panther": 1,
                "hamap": 1,
                "ncbifam": 1,
                "prosite": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 17724
        }
    }
}