GET /api/protein/UniProt/A1VYG1/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A1VYG1",
        "id": "ACCA_CAMJJ",
        "source_organism": {
            "taxId": "354242",
            "scientificName": "Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176)",
            "fullName": "Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176)"
        },
        "name": "Acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha",
        "description": [
            "Component of the acetyl coenzyme A carboxylase (ACC) complex. First, biotin carboxylase catalyzes the carboxylation of biotin on its carrier protein (BCCP) and then the CO(2) group is transferred by the carboxyltransferase to acetyl-CoA to form malonyl-CoA"
        ],
        "length": 312,
        "sequence": "MASYLDFEKNIQQIDEDIINAQIKGDTEAVSILKKNLEKEISKTYKNLSDFQRLQLARHPDRPYALDYIELILNDAHEIHGDRAFRDDPAIVCFMGYLGEKKIIVIGEQKGRGTKDKIARNFGMPHPEGYRKALRVARLAEKFQIPILFLIDTPGAYPGIGAEERGQSEAIARNLYELSDLKIPTIAIVIGEGGSGGALAIGVADRLAMMKNSVFSVISPEGCAAILWNDPAKSEAATKVMKVTADDLKSQGLIDDVIDEPTNGAHRNKEAAAVAIADYVKKSLNELENIDVRELSANRMQKILKLGAYQEA",
        "proteome": null,
        "gene": "accA",
        "go_terms": [
            {
                "identifier": "GO:0016874",
                "name": "ligase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0003989",
                "name": "acetyl-CoA carboxylase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0016743",
                "name": "carboxyl- or carbamoyltransferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006633",
                "name": "fatty acid biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0009317",
                "name": "acetyl-CoA carboxylase complex",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "c956295bae978f11e0d2fa3dea16a9cc58d6b9bf",
        "counters": {
            "domain_architectures": 19168,
            "entries": 13,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "profile": 1,
                "ncbifam": 3,
                "panther": 1,
                "pfam": 1,
                "hamap": 1,
                "prints": 1,
                "interpro": 3
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 19168
        }
    }
}