GET /api/protein/UniProt/A1T0E1/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A1T0E1",
        "id": "RL4_PSYIN",
        "source_organism": {
            "taxId": "357804",
            "scientificName": "Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)",
            "fullName": "Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)"
        },
        "name": "Large ribosomal subunit protein uL4",
        "description": [
            "One of the primary rRNA binding proteins, this protein initially binds near the 5'-end of the 23S rRNA. It is important during the early stages of 50S assembly. It makes multiple contacts with different domains of the 23S rRNA in the assembled 50S subunit and ribosome",
            "Forms part of the polypeptide exit tunnel"
        ],
        "length": 201,
        "sequence": "MELVLKDAQSALEVSETTFGREFNEALVHQVVVAYAAGARQGTRAQKTRSDVSGGGKKPWRQKGTGRARSGTIRSPIWVGGGVTFAARPQDHSQKVNKKMYRGAVKSILSELVRQDRLIVVEKFSVEAPKTQELKAKLKELDLKDVLIITEELDENLFLAARNLYKVDVRDVQGIDPVSLIAFDKVLVTAAAVKKIEESLT",
        "proteome": "UP000000639",
        "gene": "rplD",
        "go_terms": [
            {
                "identifier": "GO:0003735",
                "name": "structural constituent of ribosome",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006412",
                "name": "translation",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005840",
                "name": "ribosome",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "55256980899bda0cbbb0a12f4738c69d0597de72",
        "counters": {
            "domain_architectures": 31545,
            "entries": 9,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "hamap": 1,
                "panther": 1,
                "pfam": 1,
                "ncbifam": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 31545
        }
    }
}