GET /api/protein/UniProt/A1SSX5/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A1SSX5",
        "id": "RNFA_PSYIN",
        "source_organism": {
            "taxId": "357804",
            "scientificName": "Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)",
            "fullName": "Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)"
        },
        "name": "Ion-translocating oxidoreductase complex subunit A",
        "description": [
            "Part of a membrane-bound complex that couples electron transfer with translocation of ions across the membrane"
        ],
        "length": 192,
        "sequence": "MSDYFLLFIGTVLVNNFVLVKFLGLCPFMGVSNKIETAVGMSFATTFVLTLTAAVSYIVNKYILLPLDLVYLQTIGFILVIAVVVQFTEMVMHKTSPTLYRLLGIFLPLITTNCAILGLALLNINEDHDFVESIIYGFSAGVGFSLVLVVFSSMRERLAASDIPLPFKGGSIAMITAGLMSLAFMGFTGLIK",
        "proteome": "UP000000639",
        "gene": "rnfA",
        "go_terms": [
            {
                "identifier": "GO:0022900",
                "name": "electron transport chain",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0016020",
                "name": "membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "ab97e895e3c90b2580dc69b86b41d64f6f9b8e90",
        "counters": {
            "domain_architectures": 22630,
            "entries": 9,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "panther": 1,
                "ncbifam": 2,
                "hamap": 1,
                "pfam": 1,
                "pirsf": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 22630
        }
    }
}