GET /api/protein/UniProt/A1SSX5/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A1SSX5",
"id": "RNFA_PSYIN",
"source_organism": {
"taxId": "357804",
"scientificName": "Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)",
"fullName": "Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)"
},
"name": "Ion-translocating oxidoreductase complex subunit A",
"description": [
"Part of a membrane-bound complex that couples electron transfer with translocation of ions across the membrane"
],
"length": 192,
"sequence": "MSDYFLLFIGTVLVNNFVLVKFLGLCPFMGVSNKIETAVGMSFATTFVLTLTAAVSYIVNKYILLPLDLVYLQTIGFILVIAVVVQFTEMVMHKTSPTLYRLLGIFLPLITTNCAILGLALLNINEDHDFVESIIYGFSAGVGFSLVLVVFSSMRERLAASDIPLPFKGGSIAMITAGLMSLAFMGFTGLIK",
"proteome": "UP000000639",
"gene": "rnfA",
"go_terms": [
{
"identifier": "GO:0022900",
"name": "electron transport chain",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0016020",
"name": "membrane",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "ab97e895e3c90b2580dc69b86b41d64f6f9b8e90",
"counters": {
"domain_architectures": 22630,
"entries": 9,
"isoforms": 0,
"proteomes": 1,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"panther": 1,
"ncbifam": 2,
"hamap": 1,
"pfam": 1,
"pirsf": 1,
"interpro": 3
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 22630
}
}
}