GET /api/protein/UniProt/A1RSP9/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A1RSP9",
"id": "A1RSP9_PYRIL",
"source_organism": {
"taxId": "384616",
"scientificName": "Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3)",
"fullName": "Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3)"
},
"name": "Crossover junction endodeoxyribonuclease Hjc",
"description": [
"A structure-specific endonuclease that resolves Holliday junction (HJ) intermediates during genetic recombination. Cleaves 4-way DNA junctions introducing paired nicks in opposing strands, leaving a 5'-terminal phosphate and a 3'-terminal hydroxyl group that are subsequently ligated to produce recombinant products"
],
"length": 141,
"sequence": "MNTKRKGSAKERELANYLWERGCAVLRGCSSGGGVRKRYVPDLVVICRGTVLVFEVKYRSKHTSIKIETEKLERLIEFAKRAGGKALLLIKYGRNPWKVLEIRDRVGRDEYEKAMDLRTFIESLFTAKLEDFIIKRDNERL",
"proteome": "UP000002595",
"gene": "hjc",
"go_terms": [
{
"identifier": "GO:0003676",
"name": "nucleic acid binding",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "f309d2b16932c4072297d236e2d8c431b0641c3d",
"counters": {
"domain_architectures": 1086,
"entries": 11,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"pirsf": 1,
"panther": 1,
"hamap": 1,
"ncbifam": 1,
"pfam": 1,
"interpro": 4
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 1086
}
}
}