General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A1QZR2",
        "id": "EFTU_BORT9",
        "source_organism": {
            "taxId": "314724",
            "scientificName": "Borrelia turicatae (strain 91E135)",
            "fullName": "Borrelia turicatae (strain 91E135)"
        },
        "name": "Elongation factor Tu",
        "description": [
            "GTP hydrolase that promotes the GTP-dependent binding of aminoacyl-tRNA to the A-site of ribosomes during protein biosynthesis"
        ],
        "length": 394,
        "sequence": "MAKEVFQRTKPHMNVGTIGHVDHGKTTLTAAISIYCSKVNKDAKALKYEDIDNAPEEKARGITINARHIEYETAGMHYAHVDCPGHADYIKNMITGAAQMDAAVLLVAADSGAEPQTKEHLLLAQRMGINKIIVFLNKLDLADPELVELVEVEVLELVEKYGFPGDTPIVKGSAFGAMSNPDDPEATKCIKELLETMDNYFDLPQRDIDKPFLLAVEDVFSISGRGTVATGRIERGVIKVGQEVEIVGIRETRKTTVTGVEMFQKILEQGQAGDNVGLLLRGVDKKDIERGQVIAAIGTITPHKKFKASIYCLTKEEGGRHKPFFSGYRPQFFFRTTDVTGMVSLEGKEMVMPGDNVDIVVELISSIAMDKNVEFAVREGGRTVASGRILEILE",
        "proteome": "UP000001205",
        "gene": "tuf",
        "go_terms": [
            {
                "identifier": "GO:0003924",
                "name": "GTPase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0005525",
                "name": "GTP binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0003746",
                "name": "translation elongation factor activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006414",
                "name": "translational elongation",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "92ee2b1e37c3ba5c8f35a0631c48aafaeefcad09",
        "counters": {
            "domain_architectures": 38398,
            "entries": 31,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 5,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "ssf": 3,
                "pfam": 3,
                "profile": 1,
                "ncbifam": 5,
                "cdd": 2,
                "hamap": 1,
                "panther": 1,
                "prosite": 1,
                "prints": 1,
                "interpro": 11
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 38398
        }
    }
}