HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A1L513",
"id": "A1L513_BOVIN",
"source_organism": {
"taxId": "9913",
"scientificName": "Bos taurus",
"fullName": "Bos taurus (Bovine)"
},
"name": "N-glycosylase/DNA lyase",
"description": [
"DNA repair enzyme that incises DNA at 8-oxoG residues. Excises 7,8-dihydro-8-oxoguanine and 2,6-diamino-4-hydroxy-5-N-methylformamidopyrimidine (FAPY) from damaged DNA. Has a beta-lyase activity that nicks DNA 3' to the lesion"
],
"length": 180,
"sequence": "MVERLCQTFGPRLIQLDDVTYHGFPSLQALAGPEVEAQLRNLGLGYRARFVSASARAILEERGGLPWLQQLRKAPYEEAHKALCTLPGVGTKVADCICLMALDKPQAVPVDVHVWQIAQRDYSWHPTTSQAKGPSPQANKELGNFFRNLWGPYAGWAQAVSVPRLPLHLQPRPHRTSPWP",
"proteome": null,
"gene": "OGG1",
"go_terms": [
{
"identifier": "GO:0006284",
"name": "base-excision repair",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0003824",
"name": "catalytic activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006281",
"name": "DNA repair",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 2,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "101d5cd9986e339cda16b6cf5f3a516003f98a8c",
"counters": {
"domain_architectures": 26078,
"entries": 11,
"isoforms": 0,
"proteomes": 0,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 2,
"cdd": 1,
"smart": 1,
"ssf": 1,
"pfam": 1,
"panther": 1,
"interpro": 4
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 26078
}
}
}