General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A1L2H9",
        "id": "RFA2B_XENLA",
        "source_organism": {
            "taxId": "8355",
            "scientificName": "Xenopus laevis",
            "fullName": "Xenopus laevis (African clawed frog)"
        },
        "name": "Replication protein A 32 kDa subunit-B",
        "description": [
            "As part of the heterotrimeric replication protein A complex (RPA/RP-A), binds and stabilizes single-stranded DNA intermediates, that form during DNA replication or upon DNA stress. It prevents their reannealing and in parallel, recruits and activates different proteins and complexes involved in DNA metabolism. Thereby, it plays an essential role both in DNA replication and the cellular response to DNA damage (By similarity)"
        ],
        "length": 274,
        "sequence": "MWNNQGGFDGGSGMGGGGYMQSPGGFGSPAPTQGEKKSRSRSQQIVPCTVSQLLSATQNDEVFRIGETELSQVIIVGIVRHAEKAPTNILYKVDDMTAAPMDVRQWVDTDEASCENMVVPPGSYVKVAGHLRSFQNKKSVVAFKIAPVDDMNEFVSHMLEVVHSHMVMNSQGAPSGGGSTMALNTPGRMGIGDSGGAFSGGNDNPTNGLTPHQNQILNLIKSCKGNEGMAFEELKNRLHGMNVNSIRKTVDFLSNEGHIYSTIDDEHYKSTDGD",
        "proteome": "UP000186698",
        "gene": "rpa2-b",
        "go_terms": [
            {
                "identifier": "GO:0003677",
                "name": "DNA binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006260",
                "name": "DNA replication",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0006281",
                "name": "DNA repair",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0006310",
                "name": "DNA recombination",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005634",
                "name": "nucleus",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 2,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "7b0a9b385ab385654133fe48e858e6fa6a74c463",
        "counters": {
            "domain_architectures": 3119,
            "entries": 14,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "ssf": 2,
                "cdd": 1,
                "pfam": 1,
                "pirsf": 1,
                "panther": 1,
                "interpro": 6
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 3119
        }
    }
}