GET /api/protein/UniProt/A1K2P0/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A1K2P0",
        "id": "UBIC_AZOSB",
        "source_organism": {
            "taxId": "418699",
            "scientificName": "Azoarcus sp. (strain BH72)",
            "fullName": "Azoarcus sp. (strain BH72)"
        },
        "name": "Probable chorismate pyruvate-lyase",
        "description": [
            "Removes the pyruvyl group from chorismate, with concomitant aromatization of the ring, to provide 4-hydroxybenzoate (4HB) for the ubiquinone pathway"
        ],
        "length": 189,
        "sequence": "MQHPASGESWLARPPRTAERRLRPWLTDPASLTARIRMRCGMFGVRVLRQSAGALTPDERRLLGLRAGERALLREVLLIADGRPVVFARSVLAQREQRGGWLRLWRGIGSRPLGAALFSDPRIRRQPLACARIGAADARYHLARRALAGAATLPPALWARRSVFRLHGRSLLVSEFFLPAILGLPDDPL",
        "proteome": "UP000002588",
        "gene": "ubiC",
        "go_terms": [
            {
                "identifier": "GO:0008813",
                "name": "chorismate lyase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006744",
                "name": "ubiquinone biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005737",
                "name": "cytoplasm",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "49277cf3fbb0d6e76de8348713c4472a0cf77b34",
        "counters": {
            "domain_architectures": 5619,
            "entries": 7,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "pfam": 1,
                "hamap": 1,
                "panther": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 5619
        }
    }
}