GET /api/protein/UniProt/A1JN27/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A1JN27",
        "id": "SBMC_YERE8",
        "source_organism": {
            "taxId": "393305",
            "scientificName": "Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)",
            "fullName": "Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)"
        },
        "name": "DNA gyrase inhibitor",
        "description": [
            "Inhibits the supercoiling activity of DNA gyrase. Acts by inhibiting DNA gyrase at an early step, prior to (or at the step of) binding of DNA by the gyrase. It protects cells against toxins that target DNA gyrase, by inhibiting activity of these toxins and reducing the formation of lethal double-strand breaks in the cell"
        ],
        "length": 157,
        "sequence": "MAFKIIEKQPQQIVSIRVVGPYHETIPKGFDQLSSLYTQYQIPGKDWLVLYWDNPETNPPAELRADVSLSVADDYVLPPELSDHLQLQVIPAGLYAVYHTRVSDDDYAKAWGELYNQHLPQSGYRPTEGACYEVYLNDGRADGYFDIDIYQSVEKDQ",
        "proteome": null,
        "gene": "sbmC",
        "go_terms": [
            {
                "identifier": "GO:0008657",
                "name": "DNA topoisomerase type II (double strand cut, ATP-hydrolyzing) inhibitor activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "fc496422b8ed9c55559c94f89b2b39393d9b0294",
        "counters": {
            "domain_architectures": 11819,
            "entries": 12,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 1,
                "smart": 1,
                "ssf": 1,
                "cathgene3d": 1,
                "ncbifam": 1,
                "hamap": 1,
                "panther": 1,
                "interpro": 5
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 11819
        }
    }
}