General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A1JJN1",
        "id": "A1JJN1_YERE8",
        "source_organism": {
            "taxId": "393305",
            "scientificName": "Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)",
            "fullName": "Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)"
        },
        "name": "Hypoxanthine phosphoribosyltransferase",
        "description": [
            "Purine salvage pathway enzyme which catalyzes the transfer of the ribosyl-5-phosphate group from 5-phospho-alpha-D-ribose 1-diphosphate (PRPP) to the N9 position of hypoxanthine to yield IMP (inosine 5'-monophosphate). To a lesser extent, can also act on guanine leading to GMP, but shows a highly less efficient activity with xanthine"
        ],
        "length": 178,
        "sequence": "MKHTVEVMISEQEVKTRIAELGRQISEHYRDSGSEMVLVGLLRGSFMFMADLCRAIDVSHEVDFMTASSYGNGMSTTRDVKILKDLDEDIRGKDVLIVEDIIDSGNTLSKVREILQLRGPKSLAICTLLDKPERREVQVPVEWVGFTIPDEFVVGYGIDYAQRYRHLPYVGKVVMFDE",
        "proteome": null,
        "gene": "hpt",
        "go_terms": [
            {
                "identifier": "GO:0004422",
                "name": "hypoxanthine phosphoribosyltransferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006166",
                "name": "purine ribonucleoside salvage",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "0f8ac38f062a402c09070bf5cbec330fb03fbefd",
        "counters": {
            "domain_architectures": 136430,
            "entries": 10,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "pfam": 1,
                "cdd": 1,
                "panther": 1,
                "ncbifam": 1,
                "interpro": 4
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 136430
        }
    }
}