General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A1JIM8",
        "id": "TDCC_YERE8",
        "source_organism": {
            "taxId": "393305",
            "scientificName": "Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)",
            "fullName": "Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)"
        },
        "name": "Threonine/serine transporter TdcC",
        "description": [
            "Involved in the import of threonine and serine into the cell, with the concomitant import of a proton (symport system)"
        ],
        "length": 442,
        "sequence": "MHIDNAITTTIETKTWRKSDTTWTLGLFGTAIGAGVLFFPIRAGFGGLIPILIMLVLAYPIAFLCHRALARLCLSGSNCSGNITETVEEHFGKTGGVVITFLYFFAICPLLWIYGVTITNTFMTFWENQLQLAPLNRGVVALALLLLMAVVIYFGKDLMVKVMSFLVFPFIACLVLISLSLIPYWNASVIEQVDLSQISLLGHDGILVTVWLGISIMVFSFNFSPIVSSFVVSKREEYEPEFGREYTEKKCSQIISRASILMVAVVMFFAFSCLFTLSPQNMAEAKAQNIPVLSYLANHFSSMAGSRSTFSITLEYAASLIALVAIFKSFFGHYLGTLEGLNGLVIKFGYKGDKTKISSGKLNLISMFFIMGSTWLVAYINPNILDLIEAMGAPIIASLLCLLPMYAIHKLPSLARFRGRPENYFVTIVGLLTIFNIVYKLL",
        "proteome": null,
        "gene": "tdcC",
        "go_terms": [
            {
                "identifier": "GO:0015194",
                "name": "L-serine transmembrane transporter activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0015565",
                "name": "threonine efflux transmembrane transporter activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0015826",
                "name": "threonine transport",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0032329",
                "name": "serine transport",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0016020",
                "name": "membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0003333",
                "name": "amino acid transmembrane transport",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0015171",
                "name": "amino acid transmembrane transporter activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006865",
                "name": "amino acid transport",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "563bf97a90fdce69b83f48705e7686854a329061",
        "counters": {
            "domain_architectures": 91119,
            "entries": 10,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "pfam": 1,
                "hamap": 1,
                "ncbifam": 2,
                "panther": 1,
                "interpro": 4
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 91119
        }
    }
}