General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A1B8Z2",
        "id": "BHCB_PARDP",
        "source_organism": {
            "taxId": "318586",
            "scientificName": "Paracoccus denitrificans (strain Pd 1222)",
            "fullName": "Paracoccus denitrificans (strain Pd 1222)"
        },
        "name": "beta-hydroxyaspartate dehydratase",
        "description": [
            "Catalyzes the dehydration of (2R,3S)-beta-hydroxyaspartate ((3S)-3-hydroxy-D-aspartate) into iminosuccinate. Is essential for the growth of P.denitrificans in the presence of glycolate and glyoxylate since it functions in glyoxylate assimilation via the beta-hydroxyaspartate cycle (BHAC)"
        ],
        "length": 315,
        "sequence": "MYIPTYEDMLAAHERIKPHIRRTPIRTSDYLNELTGAQLFFKCENFQEPGAFKVRGATNAVFGLDDAQAAKGVATHSSGNHASCLSYAAMLRGIPCNVVMPRTAPQAKKDTVRRYGGVITECEPSTSSREETFAKVQAETGGDFVHPYNDPRVIAGQGTCAKELVEQVDGLDAVVAPIGGGGMISGTCLTLSTLAPETRVIAAEPEQADDAYRSFKAGYIIADDAPKTVADGLLVPLKDLTWHFVKNHVSEIYTASDAEIVDAMKLIWKHLRIVMEPSSAVPLATILKNPEAFAGKRVGVIVTGGNVDLDKLPWN",
        "proteome": "UP000000361",
        "gene": "bhcB",
        "go_terms": null,
        "protein_evidence": 1,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "8bc361cd7c1d6142f8798dedc919bc5496ed8194",
        "counters": {
            "domain_architectures": 181949,
            "entries": 9,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "cdd": 1,
                "cathgene3d": 1,
                "panther": 1,
                "ncbifam": 1,
                "pfam": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 181949
        }
    }
}