General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A1B3U2",
        "id": "LPXK_PARDP",
        "source_organism": {
            "taxId": "318586",
            "scientificName": "Paracoccus denitrificans (strain Pd 1222)",
            "fullName": "Paracoccus denitrificans (strain Pd 1222)"
        },
        "name": "Tetraacyldisaccharide 4'-kinase",
        "description": [
            "Transfers the gamma-phosphate of ATP to the 4'-position of a tetraacyldisaccharide 1-phosphate intermediate (termed DS-1-P) to form tetraacyldisaccharide 1,4'-bis-phosphate (lipid IVA)"
        ],
        "length": 329,
        "sequence": "MSRRAPDFWFQPPGLRARLLAPLGALYAAATARRLARGPRTRPGVPVICIGNLNAGGTGKTPTTIMLARLLQDRGVAVHIVSRGYGGSEKGPRRVEEARHSAAEVGDEPLLMAAFAPVWVADDRLAGARAAVEAGAQAILLDDGFQDPALAHDLSLVVVDAAKGFGNGLCLPAGPLREPVDRGLARAGLLLSIGEAAAQARFAATLGTRLPLPHLTGRLAPLQTGMDWQGQRVLAFAGIGHPEKFFATLRGLGADVVRAEALEDHQPFTPQLLIRLETESRLTGAQMVTTEKDAVRLPRSFRPKVLALPVRLQLDDAAPLEERLASLGL",
        "proteome": "UP000000361",
        "gene": "lpxK",
        "go_terms": [
            {
                "identifier": "GO:0005524",
                "name": "ATP binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0009029",
                "name": "lipid-A 4'-kinase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0009245",
                "name": "lipid A biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "ed2f6b9aa6a5389f81749814bd72058a01adf7b0",
        "counters": {
            "domain_architectures": 14571,
            "entries": 7,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "hamap": 1,
                "panther": 1,
                "pfam": 1,
                "ncbifam": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 14571
        }
    }
}