GET /api/protein/UniProt/A1B3U2/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A1B3U2",
"id": "LPXK_PARDP",
"source_organism": {
"taxId": "318586",
"scientificName": "Paracoccus denitrificans (strain Pd 1222)",
"fullName": "Paracoccus denitrificans (strain Pd 1222)"
},
"name": "Tetraacyldisaccharide 4'-kinase",
"description": [
"Transfers the gamma-phosphate of ATP to the 4'-position of a tetraacyldisaccharide 1-phosphate intermediate (termed DS-1-P) to form tetraacyldisaccharide 1,4'-bis-phosphate (lipid IVA)"
],
"length": 329,
"sequence": "MSRRAPDFWFQPPGLRARLLAPLGALYAAATARRLARGPRTRPGVPVICIGNLNAGGTGKTPTTIMLARLLQDRGVAVHIVSRGYGGSEKGPRRVEEARHSAAEVGDEPLLMAAFAPVWVADDRLAGARAAVEAGAQAILLDDGFQDPALAHDLSLVVVDAAKGFGNGLCLPAGPLREPVDRGLARAGLLLSIGEAAAQARFAATLGTRLPLPHLTGRLAPLQTGMDWQGQRVLAFAGIGHPEKFFATLRGLGADVVRAEALEDHQPFTPQLLIRLETESRLTGAQMVTTEKDAVRLPRSFRPKVLALPVRLQLDDAAPLEERLASLGL",
"proteome": "UP000000361",
"gene": "lpxK",
"go_terms": [
{
"identifier": "GO:0005524",
"name": "ATP binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0009029",
"name": "lipid-A 4'-kinase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0009245",
"name": "lipid A biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "ed2f6b9aa6a5389f81749814bd72058a01adf7b0",
"counters": {
"domain_architectures": 14571,
"entries": 7,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"hamap": 1,
"panther": 1,
"pfam": 1,
"ncbifam": 1,
"interpro": 2
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 14571
}
}
}