HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A1A095",
"id": "RPOA_BIFAA",
"source_organism": {
"taxId": "367928",
"scientificName": "Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a)",
"fullName": "Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a)"
},
"name": "DNA-directed RNA polymerase subunit alpha",
"description": [
"DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates"
],
"length": 332,
"sequence": "MLIAQRPTLTEESLNPQRSRFTIEPLEPGFGYTLGNSLRRTLLSSIPGAAVTSVRISGVPHEFTTLPGVEEDVTEILLNIKGIVLTSEYDEPVVMYLRKSGKGEATAGDITPPAGVTIANPDMHIATLAEDGELEIEFTVERGRGYVPAQMNKQDNAEIGRIPVDSIYSPVLKVSYRVEATRVEQRTDFDKLILDVETKPAISPRDAVASAGSTLVELFGLCRELNTQAEGVEVGPAPVAEETNPEMNIPIEDLNLTQRSYNCLKREGIHTIGELVAHTEQDLLDIRNFGMKSIDEVKEKLQSLGLALKASPLGNFDANNLEGGTFFSPEDE",
"proteome": "UP000008702",
"gene": "rpoA",
"go_terms": [
{
"identifier": "GO:0046983",
"name": "protein dimerization activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006351",
"name": "DNA-templated transcription",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0003899",
"name": "DNA-directed RNA polymerase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0003677",
"name": "DNA binding",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "79a14a992c1174f7ba4a2751a39d1adddb519d59",
"counters": {
"domain_architectures": 38126,
"entries": 22,
"isoforms": 0,
"proteomes": 1,
"sets": 3,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 3,
"cdd": 1,
"cathgene3d": 3,
"smart": 1,
"pfam": 3,
"hamap": 1,
"ncbifam": 4,
"interpro": 6
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 38126
}
}
}