GET /api/protein/UniProt/A0R8U9/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0R8U9",
"id": "ACPS_BACAH",
"source_organism": {
"taxId": "412694",
"scientificName": "Bacillus thuringiensis (strain Al Hakam)",
"fullName": "Bacillus thuringiensis (strain Al Hakam)"
},
"name": "Holo-[acyl-carrier-protein] synthase",
"description": [
"Transfers the 4'-phosphopantetheine moiety from coenzyme A to a Ser of acyl-carrier-protein"
],
"length": 119,
"sequence": "MIVGIGIDIIELNRIEKMLDGKLKFMERILTENERNVAKGLKGSRLTEFVAGRFAAKEAYSKAVGTGIGKEVSFLDIEVRNDDRGKPILITSTEHIVHLSISHSKEFAVAQVVLESSSS",
"proteome": null,
"gene": "acpS",
"go_terms": [
{
"identifier": "GO:0000287",
"name": "magnesium ion binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0008897",
"name": "holo-[acyl-carrier-protein] synthase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006633",
"name": "fatty acid biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "e95bd032824ec42d20f1a59244ad0c4ab2df36cb",
"counters": {
"domain_architectures": 32397,
"entries": 12,
"isoforms": 0,
"proteomes": 0,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"ncbifam": 2,
"cathgene3d": 1,
"pfam": 1,
"hamap": 1,
"panther": 1,
"interpro": 5
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 32397
}
}
}