GET /api/protein/UniProt/A0QTP2/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0QTP2",
        "id": "SIGH_MYCS2",
        "source_organism": {
            "taxId": "246196",
            "scientificName": "Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)",
            "fullName": "Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)"
        },
        "name": "ECF RNA polymerase sigma factor SigH",
        "description": [
            "Sigma factors are initiation factors that promote the attachment of RNA polymerase to specific initiation sites and are then released. Extracytoplasmic function (ECF) sigma factors are held in an inactive form by an anti-sigma factor until released. This sigma factor is involved in heat shock and oxidative stress responses"
        ],
        "length": 215,
        "sequence": "MTDVDRVEPETPPEREETDAELTARFERDAIPLLDQLYGGALRMTRNPADAEDLLQETMVKAYAGFRSFREGTNLKAWLYRILTNTYINSYRKKQRQPSEYPTDEITDWQLASNAEHSSTGLRSAEVEALEALPDTEIKAALQALPEEFRMAVYYADVEGFPYKEIAEIMETPIGTVMSRLHRGRRQLRDLLAGVARDRGFIRGPQLGEPEEVTS",
        "proteome": "UP000000757",
        "gene": "sigH",
        "go_terms": [
            {
                "identifier": "GO:0003700",
                "name": "DNA-binding transcription factor activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006352",
                "name": "DNA-templated transcription initiation",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0006355",
                "name": "regulation of DNA-templated transcription",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0003677",
                "name": "DNA binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0016987",
                "name": "sigma factor activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 1,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "579b3da2dd8aabf0c990d6b34637c9bac5955bf3",
        "counters": {
            "domain_architectures": 240935,
            "entries": 20,
            "isoforms": 2,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "ssf": 2,
                "pfam": 2,
                "cdd": 1,
                "ncbifam": 2,
                "panther": 1,
                "prosite": 1,
                "interpro": 9
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 240935
        }
    }
}