General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0Q0Z7",
        "id": "TMCAL_CLONN",
        "source_organism": {
            "taxId": "386415",
            "scientificName": "Clostridium novyi (strain NT)",
            "fullName": "Clostridium novyi (strain NT)"
        },
        "name": "tRNA(Met) cytidine acetate ligase",
        "description": [
            "Catalyzes the formation of N(4)-acetylcytidine (ac(4)C) at the wobble position of elongator tRNA(Met), using acetate and ATP as substrates. First activates an acetate ion to form acetyladenylate (Ac-AMP) and then transfers the acetyl group to tRNA to form ac(4)C34"
        ],
        "length": 400,
        "sequence": "MNITGIITEYNPLHKGHIYHINKTKELTSCDGIVCIMSGNFVQRGIPAIMDKWTRCELALNSGVDLVIELPSVYSLSSAEFFAYGSISLLNSIGIINNICFGSESGNIDDIKSIAKILNNEPSEFKNHLKDYLDKGVSYPVARSKALVEYFNDNLETQEILKSSNNILGIEYCKSLLKLKSTIIPYTIQRKGSNYNDDKLESKFSSATAIRSHVKNSKNINILKDILPSKTFNYLYDKFNNNNLVFEDSMFSFIKYKSLTLKNKLENLPDVKEGLHNKIYSELKNSNSFYELVSNIKSKRYAYTRISRILCQYFIGMENFNLEYLRTKKSPYGRVLGFNDTGRKILKEMKKKSSIPIYMKLPKTLNDTLKLDIQSTYAYSMINKSVSYDSDFKTSPIYLK",
        "proteome": "UP000008220",
        "gene": "tmcAL",
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "878d58dbcedcbd6e8647b4c564c3ab628d7123d8",
        "counters": {
            "domain_architectures": 5528,
            "entries": 8,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "pfam": 1,
                "panther": 1,
                "ncbifam": 1,
                "hamap": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 5528
        }
    }
}