GET /api/protein/UniProt/A0Q087/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0Q087",
        "id": "EFP_CLONN",
        "source_organism": {
            "taxId": "386415",
            "scientificName": "Clostridium novyi (strain NT)",
            "fullName": "Clostridium novyi (strain NT)"
        },
        "name": "Elongation factor P",
        "description": [
            "Involved in peptide bond synthesis. Stimulates efficient translation and peptide-bond synthesis on native or reconstituted 70S ribosomes in vitro. Probably functions indirectly by altering the affinity of the ribosome for aminoacyl-tRNA, thus increasing their reactivity as acceptors for peptidyl transferase"
        ],
        "length": 185,
        "sequence": "MISAGDLRKGTTFELDGQVYTVIDFLHVKPGKGAAFVRTKLRNVISGGVTETTFNPTAKLQEAVIERKEMQYLYSDGELYYFMDQETFEQIPLNFEQVENAIKFLKENMFAIIKFYKGAAFSVEAPNFVELQIVECEPGIKGNTATNAMKPAKLETGAVVNVPLFVNEGETIRVDTRTGDYMERV",
        "proteome": "UP000008220",
        "gene": "efp",
        "go_terms": [
            {
                "identifier": "GO:0003746",
                "name": "translation elongation factor activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006414",
                "name": "translational elongation",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0043043",
                "name": "peptide biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005737",
                "name": "cytoplasm",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "fc01dc10f98ced482098f920742884a9a4952237",
        "counters": {
            "domain_architectures": 28575,
            "entries": 26,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 3,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "ssf": 2,
                "pfam": 3,
                "cdd": 2,
                "smart": 2,
                "pirsf": 1,
                "ncbifam": 2,
                "hamap": 1,
                "panther": 1,
                "prosite": 1,
                "interpro": 9
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 28575
        }
    }
}