GET /api/protein/UniProt/A0PP20/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0PP20",
"id": "HIS6_MYCUA",
"source_organism": {
"taxId": "362242",
"scientificName": "Mycobacterium ulcerans (strain Agy99)",
"fullName": "Mycobacterium ulcerans (strain Agy99)"
},
"name": "Imidazole glycerol phosphate synthase subunit HisF",
"description": [
"IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisF subunit catalyzes the cyclization activity that produces IGP and AICAR from PRFAR using the ammonia provided by the HisH subunit"
],
"length": 261,
"sequence": "MYTDTGLAVRVIPCLDIDAGRVVKGVNFENLRDAGDPVELAAAYDAEGADELTFLDVTASSSGRATMLEVVRHTAEQVFIPLTVGGGVRTVADVDLLLRAGADKVSVNTAAIARPDLLADMATQFGSQCIVLSVDARKVPVGSSPTPSGWEVTTHGGRRGTGIDAVEWAARGADLGVGEILLNSMDADGTKAGFDLAMLRAVRAAVTVPVIASGGAGNVDHFAPAVAAGADAVLAASVFHFRELTIGQVKAAMAAEGNTVR",
"proteome": null,
"gene": "hisF",
"go_terms": [
{
"identifier": "GO:0000107",
"name": "imidazoleglycerol-phosphate synthase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0000105",
"name": "L-histidine biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "3e31a4b4948ec0d53fba3a5c91693bed733c63e9",
"counters": {
"domain_architectures": 51627,
"entries": 12,
"isoforms": 0,
"proteomes": 0,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"cdd": 1,
"hamap": 1,
"panther": 1,
"ncbifam": 1,
"pfam": 1,
"interpro": 5
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 51627
}
}
}