HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0LV85",
"id": "FPG_ACIC1",
"source_organism": {
"taxId": "351607",
"scientificName": "Acidothermus cellulolyticus (strain ATCC 43068 / DSM 8971 / 11B)",
"fullName": "Acidothermus cellulolyticus (strain ATCC 43068 / DSM 8971 / 11B)"
},
"name": "Formamidopyrimidine-DNA glycosylase",
"description": [
"Involved in base excision repair of DNA damaged by oxidation or by mutagenic agents. Acts as a DNA glycosylase that recognizes and removes damaged bases. Has a preference for oxidized purines, such as 7,8-dihydro-8-oxoguanine (8-oxoG). Has AP (apurinic/apyrimidinic) lyase activity and introduces nicks in the DNA strand. Cleaves the DNA backbone by beta-delta elimination to generate a single-strand break at the site of the removed base with both 3'- and 5'-phosphates"
],
"length": 284,
"sequence": "MPELPEVETIRRGLARHLVGRRIGYAEVFHPRAVRRHSGGAADFTGRLIGRRIQAVLRRGKYLWFALDSDLALLAHLGMSGQFLLADAASPSPKHLRARFAFTDGDPELRFVDQRTFGGLTLAPLIADVPASISHIAPDILDVAFDEAEFHRRFTQRRTGVKRALLDQTLISGVGNIYADEALWRARLHYATPTVDISAATCRRLLAALRAVFRAALRAGGTSFDALYVNVNGQSGFFDRSLAVYGRAGQPCRRCGTAIVREPFMNRSSFRCPACQPVPRRPHW",
"proteome": "UP000008221",
"gene": "mutM",
"go_terms": [
{
"identifier": "GO:0003906",
"name": "DNA-(apurinic or apyrimidinic site) endonuclease activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0008270",
"name": "zinc ion binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0019104",
"name": "DNA N-glycosylase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006284",
"name": "base-excision repair",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0003684",
"name": "damaged DNA binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0016799",
"name": "hydrolase activity, hydrolyzing N-glycosyl compounds",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0003676",
"name": "nucleic acid binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0008534",
"name": "oxidized purine nucleobase lesion DNA N-glycosylase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006281",
"name": "DNA repair",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "80cde816fdd044952e2dc733f0e587d4b1b6f0f6",
"counters": {
"domain_architectures": 26807,
"entries": 24,
"isoforms": 0,
"proteomes": 1,
"sets": 3,
"structures": 0,
"taxa": 1,
"dbEntries": {
"pfam": 3,
"cathgene3d": 2,
"profile": 2,
"smart": 2,
"cdd": 1,
"ssf": 3,
"ncbifam": 2,
"panther": 1,
"hamap": 1,
"interpro": 7
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 26807
}
}
}