General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0KEH8",
        "id": "GLPE_AERHH",
        "source_organism": {
            "taxId": "380703",
            "scientificName": "Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)",
            "fullName": "Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)"
        },
        "name": "Thiosulfate sulfurtransferase GlpE",
        "description": [
            "Transferase that catalyzes the transfer of sulfur from thiosulfate to thiophilic acceptors such as cyanide or dithiols. May function in a CysM-independent thiosulfate assimilation pathway by catalyzing the conversion of thiosulfate to sulfite, which can then be used for L-cysteine biosynthesis"
        ],
        "length": 107,
        "sequence": "MDQFAHISAHDAHQKLAAGAARLVDIRDPQSFETAHAVGAFHLTNGTLVRFMNEVDFDTPVIVMCYHGNSSQGAAQYLLQQGYDEVYSLDGGFEAWRREFPIQAGDA",
        "proteome": "UP000000756",
        "gene": "glpE",
        "go_terms": [
            {
                "identifier": "GO:0004792",
                "name": "thiosulfate-cyanide sulfurtransferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0005737",
                "name": "cytoplasm",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "d8b07c182f65aef6466cd58366a63f75051d79b8",
        "counters": {
            "domain_architectures": 88335,
            "entries": 13,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "cathgene3d": 1,
                "cdd": 1,
                "smart": 1,
                "pfam": 1,
                "profile": 1,
                "ncbifam": 1,
                "hamap": 1,
                "panther": 1,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 88335
        }
    }
}