HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0JTA3",
"id": "BIOB_ARTS2",
"source_organism": {
"taxId": "290399",
"scientificName": "Arthrobacter sp. (strain FB24)",
"fullName": "Arthrobacter sp. (strain FB24)"
},
"name": "Biotin synthase",
"description": [
"Catalyzes the conversion of dethiobiotin (DTB) to biotin by the insertion of a sulfur atom into dethiobiotin via a radical-based mechanism"
],
"length": 356,
"sequence": "MTIQANVPTGDETSDEASRQTSNEASSEILETARQQVLENGVGLTQAQLEEFLRLPDEALPAALQLAHEVRLKHCGEDVEVEGIISIKTGGCPEDCHFCSQSGLFDSPVRGVWLDIPELVKAAKETAATGATEFCIVAAVRCPDIKLMNQIKFAIDRINEAVDINIACSLGMLTQRQVDQLAEWGVHRYNHNLETARSYFPEVVTTHSYEERLETCNMVKAAGMELCCGALIGMGETLEQRAELAAQLAALEPHEVPLNFLNPRPGTPLENQGIMDGKDALRAIAAFRLAMPRTVLRYAGGRELTLGDLGTREGLLGGINAVIVGNYLTTLGRPATADLSLLVELNMPIKELQKTL",
"proteome": null,
"gene": "bioB",
"go_terms": [
{
"identifier": "GO:0003824",
"name": "catalytic activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0051536",
"name": "iron-sulfur cluster binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0004076",
"name": "biotin synthase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0009102",
"name": "biotin biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "7f0f975c79064d8f533ecc2b463ba7665b60a282",
"counters": {
"domain_architectures": 26666,
"entries": 22,
"isoforms": 0,
"proteomes": 0,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"cathgene3d": 1,
"profile": 1,
"smart": 2,
"pfam": 2,
"cdd": 1,
"panther": 1,
"pirsf": 1,
"sfld": 3,
"ncbifam": 1,
"hamap": 1,
"interpro": 7
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 26666
}
}
}